PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 676727016
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Sisymbrieae; Sisymbrium
Family STAT
Protein Properties Length: 684aa    MW: 77388 Da    PI: 4.881
Description STAT family protein
Gene Model
Gene Model ID Type Source Coding Sequence
676727016genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1STAT175.11.1e-542263411116
       STAT   1 ldvvllnalgqpvekdvevvasLlyadsglvveksddaeapLLisydGvefssedrplkllrGrasfklkisqLsskcdnrLfrikfeipklkkypflea 100
                ldvvl+nalgqpv+kdv+v+a+Llya+sg++vek++d eapLL+sydGvefs+ed+p++ll+G as+klkisq  skcd+rLf+ikfeip+  +ypflea
  676727016 226 LDVVLSNALGQPVRKDVKVMATLLYANSGTPVEKTSDLEAPLLVSYDGVEFSAEDKPCNLLNGYASLKLKISQHYSKCDKRLFCIKFEIPNKGSYPFLEA 325
                8*************************************************************************************************** PP

       STAT 101 vskpirCisrsrntrs 116
                v++++rCisr+r + +
  676727016 326 VTNQLRCISRTRGSVT 341
                ***********97655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF498993.34E-729166IPR013320Concanavalin A-like lectin/glucanase domain
CDDcd103381.79E-65579684No hitNo description
Gene3DG3DSA:3.30.505.106.6E-8586638IPR000980SH2 domain
SuperFamilySSF555504.18E-11587674IPR000980SH2 domain
PROSITE profilePS500019.811590643IPR000980SH2 domain
Sequence ? help Back to Top
Protein Sequence    Length: 684 aa     Download sequence    Send to blast
MAGDYAIDTE EYSLLENFNV EVEVEKQELE TFSLCFWVYL LDSTTYPSTI IRQVHSDMSV  60
SAPFLVLDEN KRMILLPLTL LHKEAPDPVN TSSWTEVPNV STTDEFPLQQ WVHVGCEVSR  120
NYMRLHICGD IVGEQVLTSL MTNGTNSDSA RKVSLFSVGG DGYSVQGFIH CGEVLPSTVP  180
VNNHYTKNPP LWLSVGKPST PEIQLDEDGI WSIVGEKESC GKIFSLDVVL SNALGQPVRK  240
DVKVMATLLY ANSGTPVEKT SDLEAPLLVS YDGVEFSAED KPCNLLNGYA SLKLKISQHY  300
SKCDKRLFCI KFEIPNKGSY PFLEAVTNQL RCISRTRGSV TPKSLNHIDH PSDGVPKVAS  360
SNGASDNLHS SSSMKRIKLG EERISESEFE DANGTSMEWR PQNHEEEEEE EEEEDHSSTD  420
SENTEVRDST AFRKYTISDS TIFRYCLGNL TERSLLLKEI TNSSRDEEVS EFADQVSLYS  480
GCSHHGYQIK MARKLIAEGT NAWILISRNY QHVHWDNVVI EIEEHFMRIA KCSSRSLTHQ  540
DFELLRRICG CYEYITQENF EKMWCWLFPV ASAISRGLIN GMWRSSSPKW IEGFVTKEDA  600
EHSLQSQEPG TFILRFPTSR SWPHPDAGSL VVTYVGHDFV IRHRLLTIDH ICDSSERYTD  660
AKPLQEMLLA EPELSRLGRI VRSI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0461800.0BT046180.1 Arabidopsis thaliana unknown protein (At1g17040) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006416749.10.0hypothetical protein EUTSA_v10006979mg
TrEMBLV4KYL30.0V4KYL3_EUTSA; Uncharacterized protein
STRINGfgenesh2_kg.7__3481__AT1G17040.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM52052645
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G17040.10.0SH2 domain protein A